PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g19210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 321aa    MW: 36148.3 Da    PI: 8.8896
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g19210genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.3e-18183237256
                 T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                 rk+ ++tkeq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  CA10g19210 183 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 237
                 788899***********************************************98 PP

2HD-ZIP_I/II1284.1e-41183273192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rl+keq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +lk
   CA10g19210 183 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCETLTEENKRLHKELQELR-ALK 273
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.34E-18173240IPR009057Homeodomain-like
PROSITE profilePS5007117.232179239IPR001356Homeobox domain
SMARTSM003896.9E-16181243IPR001356Homeobox domain
CDDcd000863.02E-15183240No hitNo description
Gene3DG3DSA:1.10.10.602.6E-17183237IPR009057Homeodomain-like
PfamPF000461.5E-15183237IPR001356Homeobox domain
PROSITE patternPS000270214237IPR017970Homeobox, conserved site
PfamPF021834.0E-10239273IPR003106Leucine zipper, homeobox-associated
SMARTSM003406.1E-25239282IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MELALSLGGE TPKPIMFLEK SSSSSSSLHE KKVNKDDLGF CMVLGKCNEG HEDENGRRKR  60
SRNHHQEVTI CSKGSSSKDL SLQLDLLPSS KNTSSQLGFP WLSQNLATEP AGLTNGPALE  120
AEEGAALSSP NSEISSFQMN FPIYRNGKLI NMKRDQYDGD YKWGNINNYS TSRASDEDDA  180
SARKKLRLTK EQSAFLEESF KEHNTLNPKQ KLALAKQLNL RPRQVEVWFQ NRRARTKLKQ  240
TEVDCEYLKK CCETLTEENK RLHKELQELR ALKSSQPFYM QLPATTLTMC PSCERVATTS  300
ATTTTXXXXX XTRRGFIIIS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1231239RRARTKLKQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2442867e-75AC244286.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-20a14 map 10, complete sequence.
GenBankHG9754497e-75HG975449.1 Solanum pennellii chromosome ch10, complete genome.
GenBankHG9755227e-75HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016543668.10.0PREDICTED: homeobox-leucine zipper protein HOX11-like
SwissprotP466653e-91HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLM1C6R81e-163M1C6R8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000609511e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-67homeobox from Arabidopsis thaliana